thymidylate synthase (?)

Je viens de recevoir une des plus inhabituelles requêtes de blogpost que j’ai eu jusqu’à présent et sur un ton absolument mystérieux. On me demande de comparer les thymidilate synthases du rat et de la souris !

La personne qui me pose la colle ne sait pas se servir des outils de comparaisons de séquences, ne saurait probablement pas où aller les chercher, elle n’a rien à voir avec le sujet !

Mystère et boule de gomme que cet intérêt soudain, qu’elle promet d’éclaircir dès que j’aurais fait le boulot.

Autant pour faire plaisir à une amie que pour savoir de quoi il retourne…

EDL37259.1 thymidylate synthase, isoform CRA_a [Mus musculus]

EDL90969.1 thymidylate synthase [Rattus norvegicus]

EAX01716.1 thymidylate synthetase, isoform CRA_a [Homo sapiens]

EDL37259  1    SLTTLLPDCSVMLVVGSELQSDAQQLSAEA------PRHGELQYLRQVEHILRCGFKKEDRTGTGTLSVFGMQARYSLRD  74
EDL90969  1    -----------MLVEGSELQSGAQQPRTEA------PQHGELQYLRQVEHIMRCGFKKEDRTGTGTLSVFGMQARYSLRD  63
EAX01716  1    -----------MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRD  69

EDL37259  75   EFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGAEYKDM  154
EDL90969  64   EFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSARQEGDLGPVYGFQWRHFGADYKDM  143
EAX01716  70   EFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDM  149

EDL37259  155  DSDYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIAS  234
EDL90969  144  DSDYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSGDMGLGVPFNIAS  223
EAX01716  150  ESD----------------------------------LPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIAS  195

EDL37259  235  YALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKVETIDDFKVEDFQIEGYNPHPTIKM  314
EDL90969  224  YALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVETIDDFKVEDFQIEGYNPHPTIKM  303
EAX01716  196  YALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKM  275

EDL37259  315  EMAV  318
EDL90969  304  EMAV  307
EAX01716  276  EMAV  279

La comparaison a été faite avec Cobalt et j’ai ajouté l’isoforme a de la TS humaine, juste pour faire beau.

Voilà, heureuse ?

Publicités

  1. par exemple
  2. par exemple « Coffee and Sci(ence)

Laisser un commentaire

Entrez vos coordonnées ci-dessous ou cliquez sur une icône pour vous connecter:

Logo WordPress.com

Vous commentez à l'aide de votre compte WordPress.com. Déconnexion / Changer )

Image Twitter

Vous commentez à l'aide de votre compte Twitter. Déconnexion / Changer )

Photo Facebook

Vous commentez à l'aide de votre compte Facebook. Déconnexion / Changer )

Photo Google+

Vous commentez à l'aide de votre compte Google+. Déconnexion / Changer )

Connexion à %s

%d blogueurs aiment cette page :